.
The Open Protein Structure Annotation Network
PDB Keyword
.

3icl

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Northeast Structural Genomics Consortium Target McR174C. To be Published
    Site NESGC
    PDB Id 3icl Target Id McR174C
    Molecular Characteristics
    Source Methylococcus capsulatus str. bath
    Alias Ids TPS31798,3.30.70.270, PF00990 Molecular Weight 17577.94 Da.
    Residues 162 Isoelectric Point 5.34
    Sequence dtvtglpnrqlfcdrllqalaaherdgnpvvllfldvdnfksindslghlvgdrllrataerirtavrd gdtvariggdeftillngakdtlngalvaqkildglaqpfvfgaqqivisvsigiavspadgetmeqll rnadtamyhaksrgknnyqffspe
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.00 Rfree 0.222
    Matthews' coefficent 1.94 Rfactor 0.208
    Waters 91 Solvent Content 36.62

    Ligand Information
    Ligands SO4 (SULFATE) x 8
    Metals

    Jmol

     
    Google Scholar output for 3icl
    1. Small angle X_ray scattering as a complementary tool for high_throughput structural studies
    TD Grant, JR Luft, JR Wolfley, H Tsuruta, A Martel - , 2011 - Wiley Online Library
     
    2. Homology Modeling of Dopamine D2 and D3 Receptors: Molecular Dynamics Refinement and Docking Evaluation
    CBM Platania, S Salomone, GM Leggio, F Drago - PLoS ONE, 2012 - dx.plos.org
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch