.
The Open Protein Structure Annotation Network
PDB Keyword
.

3i1e

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Northeast Structural Genomics Consortium Target LkR136C. To be Published
    Site NESGC
    PDB Id 3i1e Target Id LkR136C
    Molecular Characteristics
    Source Listeria innocua
    Alias Ids TPS28374,PF00595, 2.30.42.10 Molecular Weight 8727.45 Da.
    Residues 81 Isoelectric Point 6.31
    Sequence dgvyvlsvkedvpaagilhagdliteidgqsfkssqefidyihskkvgdtvkikykhgnkneeasiklt aidkkgtpgigi
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.91 Rfree 0.291
    Matthews' coefficent 2.11 Rfactor 0.236
    Waters 24 Solvent Content 41.64

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 3i1e

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch