.
The Open Protein Structure Annotation Network
PDB Keyword
.

3hze

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Northeast Structural Genomics Consortium Target TeR59. To be Published
    Site NESGC
    PDB Id 3hze Target Id TeR59
    Molecular Characteristics
    Source Thermosynechococcus elongatus
    Alias Ids TPS28451,BIG_1290, PF10674 Molecular Weight 12496.66 Da.
    Residues 106 Isoelectric Point 5.02
    Sequence matyyyilaskkflteeepleevfrerqrhyreqgkeidfwlvpepafleqpqfaeqkarcpqpaaaii stnqqfiqwlklrleyvlmgqftseevpnplaslasv
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 6
    Resolution (Å) 2.00 Rfree 0.232
    Matthews' coefficent 2.66 Rfactor 0.207
    Waters 370 Solvent Content 53.77

    Ligand Information
    Ligands PO4 (PHOSPHATE) x 1
    Metals

    Jmol

     
    Google Scholar output for 3hze

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch