.
The Open Protein Structure Annotation Network
PDB Keyword
.

3hz7

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Northeast Structural Genomics Consortium Target DhR2A. To be Published
    Site NESGC
    PDB Id 3hz7 Target Id DhR2A
    Molecular Characteristics
    Source Desulfitobacterium hafniense
    Alias Ids TPS28324,3.30.110.40, PF01206 Molecular Weight 7613.34 Da.
    Residues 72 Isoelectric Point 4.50
    Sequence tidalgqvcpipvirakkalaelgeaggvvtvlvdndisrqnlqkmaegmgyqaeylekdngvievtiv age
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.00 Rfree 0.250
    Matthews' coefficent 2.30 Rfactor 0.228
    Waters 41 Solvent Content 46.47

    Ligand Information
    Ligands _SX (SULFUR) x 1
    Metals

    Jmol

     
    Google Scholar output for 3hz7
    1. Small angle X_ray scattering as a complementary tool for high_throughput structural studies
    TD Grant, JR Luft, JR Wolfley, H Tsuruta, A Martel - , 2011 - Wiley Online Library
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch