The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal Structure of a sugar hydrolase (YeeB) from Lactococcus lactis, Northeast Structural Genomics Consortium Target KR108. To be Published
    Site NESGC
    PDB Id 3hxk Target Id KR108
    Molecular Characteristics
    Source Lactococcus lactis
    Alias Ids TPS28370,, PF07859, PF00326 Molecular Weight 30785.03 Da.
    Residues 268 Isoelectric Point 5.72
    Sequence miflstlfwynklmnkstfslndtawvdfyqlqnprqnenytfpaiiicpgggyqhisqresdplalaf laqgyqvlllnytvmnkgtnynflsqnleevqavfslihqnhkewqinpeqvfllgcsagghlaawygn seqihrpkgvilcypvtsftfgwpsdlshfnfeieniseynisekvtsstpptfiwhtaddegvpiyns lkycdrlskhqvpfeahffesgphgvslanrttapsdayclpsvhrwvswasdwlerqikn
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 4
    Resolution (Å) 3.20 Rfree 0.296
    Matthews' coefficent 2.20 Rfactor 0.256
    Waters 61 Solvent Content 44.02

    Ligand Information


    Google Scholar output for 3hxk

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch