The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal Structure of the Q81A77_BACCR Protein from Bacillus cereus. To be Published
    Site NESGC
    PDB Id 3ht4 Target Id BcR213
    Molecular Characteristics
    Source Bacillus cereus
    Alias Ids TPS28304,PF01053, PF06838, 3.40.640.10 Molecular Weight 46015.95 Da.
    Residues 423 Isoelectric Point 5.11
    Sequence mfdrlkngekiapivkevesqitevhkradeviesnqfrvlesfgkhkisdshfipttgygyddigrdt lekvyadvfgaeaglvrpqiisgthaistalfgilrpgdellyitgkpydtleeivgvrgkgvgsfkey nigynavpltegglvdfeavaaaihsntkmigiqrskgyatrpsftisqikemiafvkeikpdvvvfvd ncygefieeqepchvgadlmagsliknpgggivktggyivgkeqyveacayrltspgigaeagaslysl qemyqgfflaphvagqalkgaiftaafleklgmntspawnaprtdliqsvqfddkdrmiafcqaiqyas pinshftpyanympgyeddvimaagtfiqgasielsadgpirppyvayvqggltyshvkiaicsaidel ieknlltis
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 8
    Resolution (Å) 2.90 Rfree 0.299
    Matthews' coefficent 2.21 Rfactor 0.274
    Waters 126 Solvent Content 44.27

    Ligand Information


    Google Scholar output for 3ht4

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch