.
The Open Protein Structure Annotation Network
PDB Keyword
.

3hix

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal Structure of the Rhodanese_3 like domain from Anabaena sp Alr3790 protein. To be Published
    Site NESGC
    PDB Id 3hix Target Id NsR437I
    Molecular Characteristics
    Source Nostoc sp. pcc 7120
    Alias Ids TPS28407,3.40.250.10, PF00581 Molecular Weight 10554.24 Da.
    Residues 97 Isoelectric Point 4.94
    Sequence vlksrlewgepaftildvrdrstyndghimgamampiedlvdrasssleksrdiyvygagdeqtsqavn llrsagfehvselkgglaawkaiggpte
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.92 Rfree 0.230
    Matthews' coefficent 1.91 Rfactor 0.214
    Waters 206 Solvent Content 35.47

    Ligand Information
    Ligands
    Metals MN (MANGANESE) x 5

    Jmol

     
    Google Scholar output for 3hix
    1. Small angle X_ray scattering as a complementary tool for high_throughput structural studies
    TD Grant, JR Luft, JR Wolfley, H Tsuruta, A Martel - , 2011 - Wiley Online Library
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch