.
The Open Protein Structure Annotation Network
PDB Keyword
.

3h2s

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of the Q03B84 protein from Lactobacillus casei. To be Published
    Site NESGC
    PDB Id 3h2s Target Id LcR19
    Molecular Characteristics
    Source Lactobacillus casei
    Alias Ids TPS27261,3.40.50.720, PF01113, PF02254, PF05368 Molecular Weight 23068.78 Da.
    Residues 216 Isoelectric Point 4.83
    Sequence mkiavlgatgragsaivaearrrghevlavvrdpqkaadrlgatvatlvkeplvlteadldsvdavvda lsvpwgsgrgylhldfathlvsllrnsdtlavfilgsaslampgadhpmildfpesaasqpwydgalyq yyeyqflqmnanvnwigispseafpsgpatsyvagkdtllvgedgqshittgnmalaildqlehptair drivvrdad
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.78 Rfree 0.254
    Matthews' coefficent 2.35 Rfactor 0.193
    Waters 360 Solvent Content 47.62

    Ligand Information
    Ligands NDP (NADPH) x 2
    Metals

    Jmol

     
    Google Scholar output for 3h2s

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch