.
The Open Protein Structure Annotation Network
PDB Keyword
.

3h2b

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Northeast Structural Genomics Consortium Target CgR113A. To be published
    Site NESGC
    PDB Id 3h2b Target Id CgR113A
    Molecular Characteristics
    Source Corynebacterium glutamicum
    Alias Ids TPS27217,3.40.50.150 Molecular Weight 20969.37 Da.
    Residues 195 Isoelectric Point 4.80
    Sequence atddvskayssptfdaeallgtvisaedpdrvliepwatgvdgvildvgsgtgrwtghlaslghqiegl epatrlvelarqthpsvtfhhgtitdlsdspkrwagllawyslihmgpgelpdalvalrmavedgggll msffsgpslepmyhpvatayrwplpelaqaletagfqvtsshwdprfphayltaeas
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.00 Rfree 0.226
    Matthews' coefficent 2.16 Rfactor 0.173
    Waters 308 Solvent Content 42.96

    Ligand Information
    Ligands SAH (S-ADENOSYL-L-HOMOCYSTEINE) x 2;PPV (PYROPHOSPHATE) x 1
    Metals

    Jmol

     
    Google Scholar output for 3h2b

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch