.
The Open Protein Structure Annotation Network
PDB Keyword
.

3gwb

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of peptidase M16 inactive domain from Pseudomonas fluorescens. Northeast Structural Genomics target PlR293L. To be Published
    Site NESGC
    PDB Id 3gwb Target Id PlR293L
    Molecular Characteristics
    Source Pseudomonas fluorescens
    Alias Ids TPS28417,3.30.830.10, PF05193 Molecular Weight 45311.20 Da.
    Residues 426 Isoelectric Point 5.97
    Sequence eldgkapshrnlnvqtwstaegakvlfvearelpmfdlrlifaagssqdgnapgvalltnamlnegvag kdvgaiaqgfeglgadfgngaykdmavaslrslsavdkrepalklfaevvgkptfpadslariknqmla gfeyqkqnpgklaslelmkrlygthpyahasdgdaksippitlaqlkafhakayaagnvvialvgdlsr sdaeaiaaqvsaalpkgpalakieqpaepkasighiefpssqtslmlaqlgidrddpdyaavslgnqil ggggfgtrlmsevrekrgltygvysgftpmqargpfminlqtraemsegtlklvqdvfaeylkngptqk elddakrelagsfplstasnadivgqlgamgfynlplsyledfmrqsqeltveqvkaamnkhlnvdkmv ivsagptvaqkp
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.90 Rfree 0.2400
    Matthews' coefficent 2.35 Rfactor 0.2037
    Waters 484 Solvent Content 47.74

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 3gwb

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch