The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of a metal-dependent phosphohydrolase with conserved HD domain (yedJ) from Escherichia coli in complex with nickel ions. Northeast Structural Genomics Consortium Target ER63. To be Published
    Site NESGC
    PDB Id 3gw7 Target Id ER63
    Molecular Characteristics
    Source Escherichia coli
    Alias Ids TPS27230,1.10.472.50, 1.10.3210.10, PF01966, BIG_264 Molecular Weight 25902.90 Da.
    Residues 231 Isoelectric Point 5.89
    Sequence mdlqhwqaqfenwlknhhqhqdaahdvchfrrvwataqklaadddvdmlviltacyfhdivslaknhpq rqrssilaaeetrrllreefeqfpaekieavchaiaahsfsaqiapltteakivqdadrlealgaigla rvfavsgalgvalfdgedpfaqhrplddkryaldhfqtkllklpqtmqtargkqlaqhnahflvefmak lsaelagenegvdhkvidafssag
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 3.30 Rfree 0.294
    Matthews' coefficent 3.45 Rfactor 0.260
    Waters Solvent Content 64.33

    Ligand Information
    Metals NI (NICKEL) x 8


    Google Scholar output for 3gw7

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch