.
The Open Protein Structure Annotation Network
PDB Keyword
.

3gu3

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Northeast Structural Genomics Consortium Target BcR20. To be Published
    Site NESGC
    PDB Id 3gu3 Target Id BcR20
    Related PDB Ids 2gh1 
    Molecular Characteristics
    Source Bacillus cereus
    Alias Ids TPS8751,PF01209, PF08242, PF08241, PF05175, 3.40.50.150, 3.40.50.720 Molecular Weight 33580.60 Da.
    Residues 293 Isoelectric Point 5.09
    Sequence mletydwnnkltylkntrdlyynddyvsflvntvwkitkpvhivdygcgygylglvlmpllpegskytg idsgetllaearelfrllpydseflegdateielndkydiaichafllhmttpetmlqkmihsvkkggk iicfephwisnmasylldgekqsefiqlgvlqklfesdtqrngkdgnigmkipiylselgvkniecrvs dkvnfldsnmhhndkndlyqslkeegiagdpgdkqqfverliargltydnalaqyeaelrffkalhlhs slvyapnmkitfgeiec
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.30 Rfree 0.212
    Matthews' coefficent 4.43 Rfactor 0.184
    Waters 293 Solvent Content 72.23

    Ligand Information
    Ligands ACT (ACETATE) x 2;SAH (S-ADENOSYL-L-HOMOCYSTEINE) x 2
    Metals

    Jmol

     
    Google Scholar output for 3gu3

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch