The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of rhodanese-related protein (TVG0868615) from Thermoplasma volcanium, Northeast Structural Genomics Consortium Target TvR109A. To be Published
    Site NESGC
    PDB Id 3gk5 Target Id TvR109A
    Molecular Characteristics
    Source Thermoplasma volcanium
    Alias Ids TPS27314,, PF00581 Molecular Weight 11292.23 Da.
    Residues 100 Isoelectric Point 4.91
    Sequence syyrsinaadlyenikaytvldvrepfelifgsiansinipiselrekwkilerdkkyavicahgnrsa aaveflsqlglnivdveggiqswieegypvv
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.40 Rfree 0.243
    Matthews' coefficent 2.15 Rfactor 0.187
    Waters 47 Solvent Content 42.78

    Ligand Information


    Google Scholar output for 3gk5

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch