.
The Open Protein Structure Annotation Network
PDB Keyword
.

3ggl

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Northeast Structural Genomics Consortium Target BtR324A. To be Published
    Site NESGC
    PDB Id 3ggl Target Id BtR324A
    Molecular Characteristics
    Source Bacteroides thetaiotaomicron
    Alias Ids TPS27207,PF00754, 2.60.120.260 Molecular Weight 17945.18 Da.
    Residues 164 Isoelectric Point 4.91
    Sequence adkdtytgfciikegtkisksgwevlsfttqeasgegagnglakclidgdtetfwhakwqggsdplpyd ividmkqniqiaqvellprgrgsnnpikvvefaasednvnwtpigrfgftnqdaaleyyvksikaryir ltipddggnstvaaireldvkgtiin
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 3.00 Rfree 0.251
    Matthews' coefficent 2.96 Rfactor 0.200
    Waters 2 Solvent Content 58.43

    Ligand Information
    Ligands PEG (DI(HYDROXYETHYL)ETHER) x 1
    Metals ZN (ZINC) x 1

    Jmol

     
    Google Scholar output for 3ggl

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch