.
The Open Protein Structure Annotation Network
PDB Keyword
.

3gek

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title X-Ray structure of putative thioesterase yhdA from Lactococcus lactis. Northeast Structural Genomics Consortium Target KR113. To be published
    Site NESGC
    PDB Id 3gek Target Id KR113
    Molecular Characteristics
    Source Lactococcus lactis
    Alias Ids TPS27259,PF03061, 3.10.129.10 Molecular Weight 15065.27 Da.
    Residues 138 Isoelectric Point 6.40
    Sequence mnmidqlnitdfqvftdensdksvskiykfsskmilsdfhaqphgflnggaslalaeitagmasnaigs sqyfalgqsisanhlnskkcegfvnacglllkngkrnhvweikitdenetlisqitvvnalvpqknsdk
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 3
    Resolution (Å) 2.24 Rfree 0.25548
    Matthews' coefficent 2.11 Rfactor 0.22366
    Waters 49 Solvent Content 41.59

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 3gek

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch