.
The Open Protein Structure Annotation Network
PDB Keyword
.

3ga2

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of the Endonuclease_V (BSU36170) from Bacillus subtilis, Northeast Structural Genomics Consortium Target SR624. To be Published
    Site NESGC
    PDB Id 3ga2 Target Id SR624
    Molecular Characteristics
    Source Bacillus subtilis
    Alias Ids TPS27293,PF04493, BIG_203 Molecular Weight 26975.65 Da.
    Residues 238 Isoelectric Point 5.75
    Sequence mkvfdvhkfdmkkeqdflqvqfnlknrinlsptihpdsintgagvdlayweqdgepygvcciividadt keviekvhsmgrisvpyvsgflafrelpliieaakkletepdvflfdgngylhynhmgvathaafflgk ptigiaktylkikgcdfvtpeievgaytdiiidgevygralrtrrdvkpiflscgnyidldssyqitms linqesrlpipvrladlethvlrtfyqknhv
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.10 Rfree 0.243
    Matthews' coefficent 2.39 Rfactor 0.200
    Waters 152 Solvent Content 48.51

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 3ga2

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch