The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal Structure of Cgl0159 From Corynebacterium glutamicum (Brevibacterium flavum). Northeast Structural Genomics Target CgR115. To be Published
    Site NESGC
    PDB Id 3fok Target Id CgR115
    Molecular Characteristics
    Source Corynebacterium glutamicum
    Alias Ids TPS27219, Molecular Weight 32928.56 Da.
    Residues 307 Isoelectric Point 4.70
    Sequence mtppiispesfealrrmraaeptmvaerfkqrrkrellgedgklfivaadhpargalavgdnetamanr yellermaialsrpgvdgvlgtpdiiddlaalgllddkivvgsmnrgglrgasfemddrytgynvssmv drgvdfaktlvrinlsdagtaptleatahavneaaaaqlpimlepfmsnwvngkvvndlstdaviqsva iaaglgndssytwmklpvveemervmesttmptlllggeggndpdatfaswehaltlpgvrgltvgrtl lypqdgdvaaavdtaarlvhtdiqqftsqsi
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 10
    Resolution (Å) 2.50 Rfree 0.254
    Matthews' coefficent 2.51 Rfactor 0.225
    Waters 715 Solvent Content 51.04

    Ligand Information


    Google Scholar output for 3fok

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch