.
The Open Protein Structure Annotation Network
PDB Keyword
.

3fnj

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of the full-length lp_1913 protein from Lactobacillus plantarum, Northeast Structural Genomics Consortium Target LpR140. To be Published
    Site NESGC
    PDB Id 3fnj Target Id LpR140
    Molecular Characteristics
    Source Lactobacillus plantarum
    Alias Ids TPS27265,3.40.250.10, PF00581 Molecular Weight 13267.63 Da.
    Residues 122 Isoelectric Point 5.30
    Sequence mndkkiellttylslyidhhtvladmqnatgkyvvldvrnapaqvkkdqikgaiampakdlatrigeld paktyvvydwtggttlgktallvllsagfeayelagalegwkgmqlpvetlad
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 6
    Resolution (Å) 2.70 Rfree 0.276
    Matthews' coefficent 2.77 Rfactor 0.231
    Waters 82 Solvent Content 55.56

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 3fnj

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch