.
The Open Protein Structure Annotation Network
PDB Keyword
.

3fni

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of a diflavin flavoprotein A3 (all3895) from Nostoc sp., Northeast Structural Genomics Consortium Target NsR431A. To be Published
    Site NESGC
    PDB Id 3fni Target Id NsR431A
    Molecular Characteristics
    Source Nostoc sp. pcc 7120
    Alias Ids TPS27280,3.40.50.360 Molecular Weight 15922.09 Da.
    Residues 151 Isoelectric Point 4.62
    Sequence tkaetsigvfyvseygysdrlaqaiingitktgvgvdvvdlgaavdlqelrelvgrctglvigmspaas aasiqgalstilgsvnekqavgifetgggddepidpllskfrnlglttafpairikqtptentyklcee agtdlgqwvtrdr
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.30 Rfree 0.252
    Matthews' coefficent 2.05 Rfactor 0.210
    Waters 141 Solvent Content 40.06

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 3fni

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch