.
The Open Protein Structure Annotation Network
PDB Keyword
.

3fbk

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of the C2 domain of the human regulator of G-protein signaling 3 isoform 6 (RGP3), Northeast Structural Genomics Consortium Target HR5550A. To be Published
    Site NESGC
    PDB Id 3fbk Target Id HR5550A
    Molecular Characteristics
    Source Homo sapiens
    Alias Ids TPS27249,PF00168, 2.60.40.150 Molecular Weight 16344.01 Da.
    Residues 143 Isoelectric Point 9.44
    Sequence kvqgagqlrlsidaqdrvlllhiiegkgliskqpgtcdpyvkislipedsrlrhqktqtvpdcrdpafh ehfffpvqeeddqkrllvtvwnrasqsrqsgligcmsfgvkslltpdkeisgwyyllgehlgrtkhlkv arrrl
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.00 Rfree 0.253
    Matthews' coefficent 1.97 Rfactor 0.198
    Waters 170 Solvent Content 37.54

    Ligand Information
    Ligands SO4 (SULFATE) x 2
    Metals

    Jmol

     
    Google Scholar output for 3fbk

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch