.
The Open Protein Structure Annotation Network
PDB Keyword
.

3f4l

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title
    Site NESGC
    PDB Id 3f4l Target Id ER647
    Molecular Characteristics
    Source Escherichia coli
    Alias Ids TPS27232,3.30.360.10, PF02894, 3.40.50.720, PF03447, PF01408, 3.40.50.2300 Molecular Weight 38763.00 Da.
    Residues 345 Isoelectric Point 6.07
    Sequence mvincafigfgksttryhlpyvlnrkdswhvahifrrhakpeeqapiyshihftsdldevlndpdvklv vvcthadshfeyakraleagknvlvekpftptlaqakelfalakskgltvtpyqnrrfdscfltakkai esgklgeiveveshfdyyrpvaetkpglpqdgafyglgvhtmdqiislfgrpdhvaydirslrnkanpd dtfeaqlfygdlkaivktshlvkidypkfivhgkkgsfikygidqqetslkanimpgepgfaaddsvgv leyvndegvtvreemkpemgdygrvydalyqtithgapnyvkesevltnleilergfeqaspstvtlak
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 6
    Resolution (Å) 2.00 Rfree 0.264
    Matthews' coefficent 2.43 Rfactor 0.231
    Waters 584 Solvent Content 49.36

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 3f4l

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch