.
The Open Protein Structure Annotation Network
PDB Keyword
.

3f2z

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of the C-terminal domain of a chitobiase (BF3579) from Bacteroides fragilis, Northeast Structural Genomics Consortium Target BfR260B. To be Published
    Site NESGC
    PDB Id 3f2z Target Id BfR260B
    Molecular Characteristics
    Source Bacteroides fragilis
    Alias Ids TPS24555,PF00754, 2.60.120.260 Molecular Weight 16586.68 Da.
    Residues 150 Isoelectric Point 6.10
    Sequence gdklsktdwkivsftteeasgegsnnghakhlidgnietfwhsrwqggsdplpyeiiidmnhrvkiaqi ellprgrgsnnpikvvrfeasedgtnwesigqfgftnqdaalkyyvksstaryiklvipdgvgngtvaa ireldvrgtvvn
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.30 Rfree 0.17455
    Matthews' coefficent 2.21 Rfactor 0.15520
    Waters 386 Solvent Content 44.36

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 3f2z

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch