The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of the general stress protein 14 (TDE0354) in complex with FMN from Treponema denticola, Northeast Structural Genomics Consortium Target TdR58. To be Published
    Site NESGC
    PDB Id 3f2v Target Id TdR58
    Molecular Characteristics
    Source Treponema denticola
    Alias Ids TPS24584,PF02525, Molecular Weight 20794.49 Da.
    Residues 184 Isoelectric Point 6.65
    Sequence mpktliilahpnisqstvhkhwsdavrqhtdrftvhelyavypqgkidvaaeqkliethdslvwqfpiy wfncppllkqwldevltygwaygskgkalkgrkialavslgapaadyradgavgcsvaevlrpfeltak ycnadyrppftfhtidsnagyseaarqeversardylawldalqqt
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.00 Rfree 0.228
    Matthews' coefficent 2.11 Rfactor 0.204
    Waters 105 Solvent Content 41.67

    Ligand Information
    Ligands FMN (FLAVIN) x 1


    Google Scholar output for 3f2v

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch