.
The Open Protein Structure Annotation Network
PDB Keyword
.

3f2i

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of the alr0221 protein from Nostoc, Northeast Structural Genomics Consortium Target NsR422. To be Published
    Site NESGC
    PDB Id 3f2i Target Id NsR422
    Molecular Characteristics
    Source Nostoc sp. pcc 7120
    Alias Ids TPS24574,PF00300, 3.40.50.1240 Molecular Weight 18622.67 Da.
    Residues 164 Isoelectric Point 7.76
    Sequence melylirhgiaeaqktgikdeereltqegkqktekvayrlvklgrqfdlivtsplirarqtaeillasg lscqleesnhlapngnifnwldywlkpknfpenaqiaivghepclsnwteillwgeakdslvlkkagmi glklpeigspvgrsqmfwltppryll
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 6
    Resolution (Å) 2.00 Rfree 0.240
    Matthews' coefficent 2.37 Rfactor 0.196
    Waters 411 Solvent Content 48.05

    Ligand Information
    Ligands PO4 (PHOSPHATE) x 6
    Metals CL (CHLORIDE) x 6

    Jmol

     
    Google Scholar output for 3f2i

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch