.
The Open Protein Structure Annotation Network
PDB Keyword
.

3f1t

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of the Q9I3C8_PSEAE protein from Pseudomonas aeruginosa. To be Published
    Site NESGC
    PDB Id 3f1t Target Id PaR319A
    Molecular Characteristics
    Source Pseudomonas aeruginosa
    Alias Ids TPS24576,PF03061, 3.10.129.10 Molecular Weight 15394.89 Da.
    Residues 140 Isoelectric Point 5.42
    Sequence msenpllerarrflsalrhcqvlgltveaadekgltlrlpysqaiignpesgvvhggaittlmdttcgi stvcvlpdfeicptldlridymhpaephkdvygfaecyrvtpnviftrgfayqddpgqpiahvvgafmr mg
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 4
    Resolution (Å) 2.20 Rfree 0.24915
    Matthews' coefficent 2.16 Rfactor 0.21713
    Waters 245 Solvent Content 43.11

    Ligand Information
    Ligands
    Metals MG (MAGNESIUM) x 2

    Jmol

     
    Google Scholar output for 3f1t

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch