.
The Open Protein Structure Annotation Network
PDB Keyword
.

3exz

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of the MaoC-like dehydratase from Rhodospirillum rubrum. To be Published
    Site NESGC
    PDB Id 3exz Target Id RrR103A
    Molecular Characteristics
    Source Rhodospirillum rubrum
    Alias Ids TPS24578,3.10.129.10, PF01575 Molecular Weight 15637.81 Da.
    Residues 145 Isoelectric Point 6.21
    Sequence glfledlavgdrfdsarhrveaaaikafagefdpqpfhldeeaarhslfgglaasgwhtaaitmrllvt sglplaqgiigagtelswpnptrpgdelhvettvlaitpsksrpdraivtcqsdtlnqrgevvqrstak vvvfrrp
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 5
    Resolution (Å) 2.30 Rfree 0.212
    Matthews' coefficent 2.61 Rfactor 0.193
    Waters 349 Solvent Content 52.80

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 3exz

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch