.
The Open Protein Structure Annotation Network
PDB Keyword
.

3exa

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of the full-length tRNA isopentenylpyrophosphate transferase (BH2366) from Bacillus halodurans, Northeast Structural Genomics Consortium target BhR41. To be Published
    Site NESGC
    PDB Id 3exa Target Id BhR41
    Related PDB Ids 2qgn 
    Molecular Characteristics
    Source Bacillus halodurans
    Alias Ids TPS8763,3.40.50.300, PF01745, PF01715 Molecular Weight 35760.98 Da.
    Residues 314 Isoelectric Point 5.91
    Sequence mkeklvaivgptavgktktsvmlakrlngevisgdsmqvyrgmdigtakitaeemdgvphhlidikdps esfsvadfqdlatpliteihergrlpflvggtglyvnavihqfnlgdiradedyrheleafvnsygvqa lhdklskidpkaaaaihpnnyrrviraleiikltgktvteqarheeetpspynlvmigltmerdvlydr inrrvdqmveeglideakklydrgirdcqsvqaigykemydyldgnvtleeaidtlkrnsrryakrqlt wfrnkanvtwfdmtdvdfdkkimeihnfiagkleeksk
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 4
    Resolution (Å) 2.30 Rfree 0.263
    Matthews' coefficent 2.44 Rfactor 0.220
    Waters 565 Solvent Content 49.54

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 3exa
    1. RNA-Protein Mutually Induced Fit
    E Seif, BM Hallberg - Journal of Biological Chemistry, 2009 - ASBMB
     
    2. Snapshots of dynamics in synthesizing N 6-isopentenyladenosine at the tRNA anticodon
    S Chimnaronk, F Forouhar, J Sakai, M Yao - Biochemistry, 2009 - ACS Publications
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch