The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of an uncharacterized protein from Erwinia carotovora subsp. atroseptica. Northeast Structural Genomics target EwR179. To be Published
    Site NESGC
    PDB Id 3esi Target Id EwR179
    Molecular Characteristics
    Source Erwinia carotovora
    Alias Ids TPS24564,, PF07977 Molecular Weight 14637.19 Da.
    Residues 129 Isoelectric Point 5.44
    Sequence mlpvelvrhdvkktdetsqvelmlqvdpdlfwfnghftgqpllpgvaqldwvmhyattvlaqgwtflsi enikfqqpilpgktlrlvliwhagkqsltfsysilegdtertassgkikltpimednpcq
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 4
    Resolution (Å) 2.50 Rfree 0.263
    Matthews' coefficent 3.16 Rfactor 0.244
    Waters 74 Solvent Content 61.14

    Ligand Information


    Google Scholar output for 3esi

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch