.
The Open Protein Structure Annotation Network
PDB Keyword
.

3esh

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of a probable metal-dependent hydrolase from Staphylococcus aureus. Northeast Structural Genomics target ZR314. To be Published
    Site NESGC
    PDB Id 3esh Target Id ZR314
    Molecular Characteristics
    Source Staphylococcus aureus
    Alias Ids TPS24586,PF00753, 3.60.15.10 Molecular Weight 32172.58 Da.
    Residues 280 Isoelectric Point 5.58
    Sequence mkigdisihylnggntkmdggamfgvvpkplwskqynanernqinlpthpiliqtaqynliidagigng klsekqlrnfgvdeeshiiadlanynltpkdidyvlmthmhfdhaagltdqaghaifenaihvvqqdew hefiapnirskstywdknkgdysnklilfekhfepvpgikmqhsgghsfghtiitiesqgdkavhmgdi fpttahknplwvtayddypmqsirekermipyfiqqqywflfyhdenyfavkysddgenidayilretl vdnn
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 3
    Resolution (Å) 2.50 Rfree 0.274
    Matthews' coefficent 2.54 Rfactor 0.228
    Waters 166 Solvent Content 51.67

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 3esh

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch