.
The Open Protein Structure Annotation Network
PDB Keyword
.

3erj

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of the peptidyl-tRNA hydrolase AF2095 from Archaeglobus fulgidis. Northeast Structural Genomics Consortium target GR4. To be Published
    Site NESGC
    PDB Id 3erj Target Id GR4
    Related PDB Ids 1rzw 
    Molecular Characteristics
    Source Archaeoglobus fulgidus
    Alias Ids TPS8893,PF01981, 6058, 3.40.1490.10 Molecular Weight 12486.12 Da.
    Residues 115 Isoelectric Point 9.56
    Sequence mtlkqvivvrddlklsrgklavqvahaaiigylksdsslrrkwldegqkkvvlkvksleellgikhkae slglvtglvqdagltevppgtitavvigpdeerkidkvtgnlpllk
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.80 Rfree 0.224
    Matthews' coefficent 2.00 Rfactor 0.195
    Waters 152 Solvent Content 38.38

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 3erj

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch