The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Three-dimensional structure of the protein priB from Ralstonia solanacearum at the resolution 2.3A. Northeast Structural Genomics Consortium target RsR213C. To be Published
    Site NESGC
    PDB Id 3en2 Target Id RsR213C
    Molecular Characteristics
    Source Ralstonia solanacearum
    Alias Ids TPS24580, Molecular Weight 9956.08 Da.
    Residues 93 Isoelectric Point 9.24
    Sequence ainrlqlvatlaerevmrytpagvpivncllsysgqameaqaarqvefsiealgagkmasvldriapgt vlecvgflarkhrsskalvfhisg
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.30 Rfree 0.240
    Matthews' coefficent 3.93 Rfactor 0.225
    Waters 77 Solvent Content 68.74

    Ligand Information
    Metals K (POTASSIUM) x 2


    Google Scholar output for 3en2

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch