The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site NESGC
    PDB Id 3e48 Target Id ZR319
    Molecular Characteristics
    Source Staphylococcus aureus
    Alias Ids TPS20400,, PF01370, PF05368 Molecular Weight 31855.70 Da.
    Residues 281 Isoelectric Point 5.86
    Sequence mnimltgatghlgthitnqaianhidhfhigvrnvekvpddwrgkvsvrqldyfnqesmveafkgmdtv vfipsiihpsfkripevenlvyaakqsgvahiifigyyadqhnnpfhmspyfgyasrllstsgidytyv rmamymdplkpylpelmnmhkliypagdgrinyitrndiargviaiiknpdtwgkryllsgysydmkel aailseasgteikyepvsletfaemydepkgfgallasmyhagarglldqesndfkqlvndqpqtlqsf lqeni
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.60 Rfree 0.205
    Matthews' coefficent 2.31 Rfactor 0.185
    Waters 637 Solvent Content 46.64

    Ligand Information
    Metals MG (MAGNESIUM) x 2


    Google Scholar output for 3e48

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch