.
The Open Protein Structure Annotation Network
PDB Keyword
.

3e29

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title X-Ray structure of the protein Q7WE92_BORBR from thioesterase superfamily. Northeast Structural Genomics Consortium Target BoR214A. To be Published
    Site NESGC
    PDB Id 3e29 Target Id BoR214A
    Molecular Characteristics
    Source Bordetella bronchiseptica
    Alias Ids TPS20374,PF03061, 3.10.129.10 Molecular Weight 14795.18 Da.
    Residues 136 Isoelectric Point 7.03
    Sequence msstalemasrfvnrspfnrwlgmsvleageqgivlgikwreelisspeirsthggilatlvdaagdya valktghpvptmdmhvdyhrvatpgdlraegqvihfgkrfataharvldmdgnlvasgralylirap
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 4
    Resolution (Å) 2.40 Rfree 0.25829
    Matthews' coefficent 3.38 Rfactor 0.22064
    Waters 182 Solvent Content 63.62

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 3e29

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch