.
The Open Protein Structure Annotation Network
PDB Keyword
.

3e1e

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of a Thioesterase family protein from Silicibacter pomeroyi. NorthEast Structural Genomics target SiR180A. To be Published
    Site NESGC
    PDB Id 3e1e Target Id SiR180A
    Molecular Characteristics
    Source Silicibacter pomeroyi
    Alias Ids TPS20394,PF03061, 3.10.129.10 Molecular Weight 15333.77 Da.
    Residues 141 Isoelectric Point 5.70
    Sequence eprfagyaqkvrdsfarqpvmatlgaridtllpgrvelcmpydraltqqhgflhagivstvldsacgya afslmeeeaavltvefkvnflnpaegerfafraevvkpgrtltvatatayafrdgeeraiatmtatlma lig
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 8
    Resolution (Å) 2.00 Rfree 0.252
    Matthews' coefficent 2.16 Rfactor 0.223
    Waters 406 Solvent Content 42.95

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 3e1e

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch