.
The Open Protein Structure Annotation Network
PDB Keyword
.

3dr5

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of the Q8NRD3_CORGL protein from Corynebacterium glutamicum. To be Published
    Site NESGC
    PDB Id 3dr5 Target Id CgR117
    Molecular Characteristics
    Source Corynebacterium glutamicum
    Alias Ids TPS8795,3.40.50.150, PF01596 Molecular Weight 22723.26 Da.
    Residues 213 Isoelectric Point 4.87
    Sequence msnafeylrtyvesttetdaavararedaaefglpapdemtgqllttlaattngngstgaiaitpaagl vglyilngladnttltcidpesehqrqakalfreagyspsrvrfllsrpldvmsrlandsyqlvfgqvs pmdlkalvdaawpllrrggalvladalldgtiadqtrkdrdtqaardadeyirsiegahvarlplgagl tvvtka
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.25 Rfree 0.231
    Matthews' coefficent 2.33 Rfactor 0.211
    Waters 170 Solvent Content 47.13

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 3dr5
    1. A New Library of Surface Patches: Design and Applications
    R Gamliel, K Kedem, R Kolodny, C Keasar - 2009 - cs.bgu.ac.il
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch