.
The Open Protein Structure Annotation Network
PDB Keyword
.

3dm3

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of a domain of a Replication factor A protein, from Methanocaldococcus jannaschii. NorthEast Structural Genomics target MjR118E. To be Published
    Site NESGC
    PDB Id 3dm3 Target Id MjR118E
    Molecular Characteristics
    Source Methanococcus jannaschii
    Alias Ids TPS31773,PF01336, 2.40.50.140 Molecular Weight 11726.65 Da.
    Residues 105 Isoelectric Point 5.03
    Sequence eikdtynigelspgmtatfegevisalpikefkradgsigklksfivrdetgsirvtlwdnltdidvgr gdyvrvrgyiregyygglectanyveilkkgekies
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 3
    Resolution (Å) 2.40 Rfree 0.274
    Matthews' coefficent 2.95 Rfactor 0.225
    Waters 188 Solvent Content 58.34

    Ligand Information
    Ligands
    Metals NA (SODIUM) x 3

    Jmol

     
    Google Scholar output for 3dm3
    1. The structure of SSO2064, the first representative of Pfam family PF01796, reveals a novel two-domain zinc-ribbon OB-fold architecture with a potential acyl-CoA-
    SS Krishna, L Aravind, C Bakolitsa - Section F: Structural , 2010 - scripts.iucr.org
     
    2. A New Library of Surface Patches: Design and Applications
    R Gamliel, K Kedem, R Kolodny, C Keasar - 2009 - cs.bgu.ac.il
     
    3. Rational design of additives for inhibition of protein aggregation
    D Shukla - 2011 - dspace.mit.edu
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch