.
The Open Protein Structure Annotation Network
PDB Keyword
.

3dhn

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of the putative epimerase Q89Z24_BACTN from Bacteroides thetaiotaomicron. To be Published
    Site NESGC
    PDB Id 3dhn Target Id BtR310
    Molecular Characteristics
    Source Bacteroides thetaiotaomicron
    Alias Ids TPS8780,PF01073, 3.50.50.60, 3.40.50.720, PF01113, PF01370, PF05368 Molecular Weight 24204.67 Da.
    Residues 219 Isoelectric Point 5.57
    Sequence mekvkkivligasgfvgsallnealnrgfevtavvrhpekikienehlkvkkadvssldevcevckgad avisafnpgwnnpdiydetikvyltiidgvkkagvnrflmvggagslfiapglrlmdsgevpenilpgv kalgefylnflmkekeidwvffspaadmrpgvrtgryrlgkddmivdivgnshisvedyaaamideleh pkhhqerftigy
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.00 Rfree 0.243
    Matthews' coefficent 2.53 Rfactor 0.232
    Waters 123 Solvent Content 51.32

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 3dhn
    1. A New Library of Surface Patches: Design and Applications
    R Gamliel, K Kedem, R Kolodny, C Keasar - 2009 - cs.bgu.ac.il
     
    2. 2 A Review of REDCRAFT: Simultaneous Investigation of Structure and Dynamics of Proteins from RDC Restraints
    H Valafar, M Simin, S Irausquin - Annual Reports on NMR , 2012 - books.google.com
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch