.
The Open Protein Structure Annotation Network
PDB Keyword
.

3db9

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of UPF0317 protein Atu3911 from Agrobacterium tumefaciens. NorthEast Strcutural Genomics target AtR186 (CASP Target). TO BE PUBLISHED
    Site NESGC
    PDB Id 3db9 Target Id AtR186
    Molecular Characteristics
    Source Agrobacterium tumefaciens
    Alias Ids TPS8729,3.40.1640.10, BIG_218, PF07286 Molecular Weight 28935.40 Da.
    Residues 269 Isoelectric Point 5.61
    Sequence mtiptsylnhtdaeaarkaratyrdglvaptsgiapgftqanmivlprdwafdfllyaqrnpkpcpvld vsdpgspttllapgadlrtdlplyriwrdgklaeetadatsawaerddlvafligcsftfetpmveagi eirhmtdksnvpmyltnrpcrpagrlkgnmvvsmrpipasrvadaatisgrfpavhgapvhvgapeqig isdlskpdfgdavriepgevpvfwacgvtpqaavmasgvpfaithapghmfitdipdtayha
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.80 Rfree 0.268
    Matthews' coefficent 2.16 Rfactor 0.229
    Waters 128 Solvent Content 43.03

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 3db9

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch