.
The Open Protein Structure Annotation Network
PDB Keyword
.

3d3n

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of lipase/esterase (lp_2923) from Lactobacillus plantarum. Northeast Structural Genomics Consortium target LpR108. To be Published
    Site NESGC
    PDB Id 3d3n Target Id LpR108
    Molecular Characteristics
    Source Lactobacillus plantarum
    Alias Ids TPS8953,3.40.50.1820, PF07859 Molecular Weight 30416.98 Da.
    Residues 276 Isoelectric Point 6.33
    Sequence mqveqrtlntaahpfqitaywldqisdfetavdypimiicpgggftyhsgreeapiatrmmaagmhtvv lnyqlivgdqsvypwalqqlgatidwittqasahhvdcqriilagfsagghvvatyngvatqpelrtry hldhyqgqhaaiilgypvidltagfpttsaarnqittdarlwaaqrlvtpaskpafvwqtatdesvppi nslkyvqamlqhqvatayhlfgsgihglalanhvtqkpgkdkylndqaaiwpqlalrwlqeqgllagny
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.50 Rfree 0.263
    Matthews' coefficent 2.31 Rfactor 0.216
    Waters 98 Solvent Content 46.84

    Ligand Information
    Ligands EPE (4-(2-HYDROXYETHYL)-1-PIPERAZINE) x 2
    Metals CA (CALCIUM) x 1

    Jmol

     
    Google Scholar output for 3d3n
    1. The crystal structure of an esterase from the hyperthermophilic microorganism Pyrobaculum calidifontis VA1 explains its enantioselectivity
    GJ Palm, E Fernndez-lvaro, X Bogdanovi_ - Applied microbiology , 2011 - Springer
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch