The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of YflH protein from Bacillus subtilis. To be Published
    Site NESGC
    PDB Id 3d0w Target Id SR326
    Molecular Characteristics
    Source Bacillus subtilis
    Alias Ids TPS9080,PF11588 Molecular Weight 12022.12 Da.
    Residues 104 Isoelectric Point 4.97
    Sequence mnrdqekiqienemnamhgtikedilkdfeefkgylkkqvnrgkklglddgklvksaailgdylakhee pqngeemllqelwsvadedekehlaqllvklvdkq
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 4
    Resolution (Å) 2.00 Rfree 0.242
    Matthews' coefficent 2.23 Rfactor 0.216
    Waters 323 Solvent Content 44.95

    Ligand Information


    Google Scholar output for 3d0w

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch