The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Molecular insights into the biosynthesis of the f420 coenzyme. J.Biol.Chem. 283 11832-11840 2008
    Site NESGC
    PDB Id 3cgw Target Id MaR46
    Related PDB Ids 3c3e 3c3d 
    Molecular Characteristics
    Source Methanosarcina mazei
    Alias Ids TPS8970,,, PF01933 Molecular Weight 33355.23 Da.
    Residues 303 Isoelectric Point 4.69
    Sequence miifsggtgtpklldglkeilpeeeltvvvntaedlwvsgnlispdldtvlylfsdqidrkrwwgiend tfgtyermkelgieeglklgdrdrathiirsniirdgasltdstvklsslfgikanilpmsddpvstyi etaegimhfqdfwigkrgepdvrgvdirgvseasispkvleafekeeniligpsnpitsigpiislpgm rellkkkkvvavspiignapvsgpagklmpacgievssmgvaeyyqdfldvfvfderdradefaferlg chasradtlmtstekskelaeivvqaf
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 3.10 Rfree 0.277
    Matthews' coefficent 3.34 Rfactor 0.239
    Waters Solvent Content 63.13

    Ligand Information


    Google Scholar output for 3cgw
    1. Molecular insights into the biosynthesis of the F420 coenzyme
    F Forouhar, M Abashidze, H Xu, LL Grochowski - Journal of Biological , 2008 - ASBMB

    Protein Summary

    Ligand Summary




    No references found.

    Tag page

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch