.
The Open Protein Structure Annotation Network
PDB Keyword
.

3cfu

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of the yjhA protein from Bacillus subtilis. To be Published
    Site NESGC
    PDB Id 3cfu Target Id SR562
    Molecular Characteristics
    Source Bacillus subtilis
    Alias Ids TPS9108,2.60.40.1240, PF11611 Molecular Weight 21979.57 Da.
    Residues 194 Isoelectric Point 5.23
    Sequence msqssdasekekpkekksqeelekeldkelkkggepktkkddqihkigetfkaghtnftvnkvdrvqkg eymnvggavneetktikddeerliievtmenigedsisynfigfdlrdkndqsvrpvfsieekgrilmg gtlvsgkkvtgvlsyvipkgeqkhytlvynpfladtnssnteervkddidylvkld
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.40 Rfree 0.254
    Matthews' coefficent 2.34 Rfactor 0.231
    Waters 89 Solvent Content 47.35

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 3cfu

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch