.
The Open Protein Structure Annotation Network
PDB Keyword
.

3ceu

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of thiamine phosphate pyrophosphorylase (BT_0647) from Bacteroides thetaiotaomicron. Northeast Structural Genomics Consortium target BtR268. To be Published
    Site NESGC
    PDB Id 3ceu Target Id BtR268
    Molecular Characteristics
    Source Bacteroides thetaiotaomicron
    Alias Ids TPS8778,3.20.20.70, PF02581 Molecular Weight 23419.67 Da.
    Residues 202 Isoelectric Point 5.80
    Sequence mklivvttptffveedkiitalfeegldilhlrkpetpamyserlltlipekyhrrivthehfylkeef nlmgihlnarnpsephdyaghvscschsveevknrkhfydyvfmspiydsiskvnyystytaeelreaq kakiidskvmalgginednlleikdfgfggavvlgdlwnkfdacldqnylaviehfkklkklad
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.30 Rfree 0.232
    Matthews' coefficent 2.04 Rfactor 0.197
    Waters 136 Solvent Content 39.78

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 3ceu

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch