.
The Open Protein Structure Annotation Network
PDB Keyword
.

3cet

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of the pantheonate kinase-like protein Q6M145 at the resolution 1.8 A. Northeast Structural Genomics Consortium target MrR63. To be Published
    Site NESGC
    PDB Id 3cet Target Id MrR63
    Related PDB Ids 3c0b 
    Molecular Characteristics
    Source Methanococcus maripaludis
    Alias Ids TPS8980,PF01968, 3.30.420.40, 3.30.420.190 Molecular Weight 35905.83 Da.
    Residues 326 Isoelectric Point 4.89
    Sequence milgidiggantkitelhengefkvhhlyfpmwknndklaevlktyskdishvalvttaeladsyetkk egvdnilnaaesafgsnisvfdsdgnfislegaktnymkvsasnwcgtakwvsknieencilvdmgstt tdiipivdgkvvaektdlerlmnhellyvgtlrtpishlgntilfkgvntnvsseyfaitadisvvlek vtteeytcdtpdgkgtdkrsslvriskvlcsdldqiseidaeniaktyyelwkelilenvkkvaekygs kkvvitgigenilkdalgdfevisvaerygkdvslatpsfavaellknel
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.80 Rfree 0.246
    Matthews' coefficent 2.79 Rfactor 0.219
    Waters 304 Solvent Content 55.85

    Ligand Information
    Ligands SO4 (SULFATE) x 2
    Metals

    Jmol

     
    Google Scholar output for 3cet

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch