.
The Open Protein Structure Annotation Network
PDB Keyword
.

3c4a

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of vioD hydroxylase in complex with FAD from Chromobacterium violaceum. To be Published
    Site NESGC
    PDB Id 3c4a Target Id CvR158
    Molecular Characteristics
    Source Chromobacterium violaceum
    Alias Ids TPS8806,3.50.50.60, 3.40.50.720 Molecular Weight 41620.45 Da.
    Residues 373 Isoelectric Point 6.15
    Sequence mkilvigagpaglvfasqlkqarplwaidivekndeqevlgwgvvlpgrpgqhpanplsyldaperlnp qfledfklvhhnepslmstgvllcgverrglvhalrdkcrsqgiairfespllehgelpladydlvvla ngvnhktahftealvpqvdygrnkyiwygtsqlfdqmnlvfrthgkdifiahaykysdtmstfivecse etyararlgemseeasaeyvakvfqaelgghglvsqpglgwrnfmtlshdrchdgklvllgdalqsghf sighgttmavvvaqllvkalctedgvpaalkrfeeralplvqlfrghadnsrvwfetveermhlssaef vqsfdarrkslppmpealaqnlryalqr
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.30 Rfree 0.262
    Matthews' coefficent 2.05 Rfactor 0.202
    Waters 86 Solvent Content 39.98

    Ligand Information
    Ligands FAD (FLAVIN-ADENINE) x 1
    Metals

    Jmol

     
    Google Scholar output for 3c4a
    1. Structure of the PLP degradative enzyme 2-methyl-3-hydroxypyridine-5-carboxylic acid oxygenase from Mesorhizobium loti MAFF303099 and its mechanistic
    KM McCulloch, T Mukherjee, TP Begley, SE Ealick - Biochemistry, 2009 - ACS Publications
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch