.
The Open Protein Structure Annotation Network
PDB Keyword
.

3c37

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title X-ray structure of the putative Zn-dependent peptidase Q74D82 at the resolution 1.7 A. To be Published
    Site NESGC
    PDB Id 3c37 Target Id GsR143A
    Molecular Characteristics
    Source Geobacter sulfurreducens
    Alias Ids TPS8901,BIG_747, PF01435 Molecular Weight 27377.79 Da.
    Residues 245 Isoelectric Point 6.98
    Sequence matsmtdikgfnmisieqekelgnkfaveiekqqqpvndpevqryvdkvgkrllsgaravefdyvfkvv kddsvnafaipggrvyvhtgllkaadnetelagvlaheinhavarhgtrqmtqeygyslvlslvlgdnp nmlaqlagqlfgkagmmsysreyenqadflgvetmykagynpngltsffqklnamdggtqsnvarffst hpltseriqrvqaeiaklppqryltdetefkkikgrlk
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.70 Rfree 0.25386
    Matthews' coefficent 1.79 Rfactor 0.21928
    Waters 248 Solvent Content 31.32

    Ligand Information
    Ligands PEG (DI(HYDROXYETHYL)ETHER) x 2
    Metals ZN (ZINC) x 2

    Jmol

     
    Google Scholar output for 3c37
    1. Structural Modeling and Biochemical Characterization of Recombinant KPN_02809, a Zinc-Dependent Metalloprotease from Klebsiella pneumoniae MGH 78578
    MT Wong, SB Choi, CS Kuan, SL Chua - International journal of , 2012 - mdpi.com
     
    2. Klebsiella pneumoniae yggG gene product: A zinc-dependent metalloprotease
    CS Kuan, MT Wong, SB Choi, CC Chang - International journal of , 2011 - mdpi.com
     
    3. The Structure of Mlc Titration Factor A (MtfA/YeeI) Reveals a Prototypical Zinc Metallopeptidase Related to Anthrax Lethal Factor
    Q Xu, AK Ghler, A Kosfeld, D Carlton - Journal of , 2012 - Am Soc Microbiol
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch