.
The Open Protein Structure Annotation Network
PDB Keyword
.

3bdu

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of protein Q6D8G1 at the resolution 1.9 A. To be Published
    Site NESGC
    PDB Id 3bdu Target Id EwR22A
    Molecular Characteristics
    Source Erwinia carotovora
    Alias Ids TPS8884,2.30.30.100, PF06004 Molecular Weight 6033.40 Da.
    Residues 54 Isoelectric Point 5.61
    Sequence mssnyvlhtndgrtivaegkpkvddetgmisytdaygqqqqinrdnvkemakgk
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 7
    Resolution (Å) 1.90 Rfree 0.247
    Matthews' coefficent 1.99 Rfactor 0.210
    Waters 170 Solvent Content 38.13

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 3bdu

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch