.
The Open Protein Structure Annotation Network
PDB Keyword
.

3bdr

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title The crystal structure of fatty acid-binding protein-like Ycf58 from Thermosynecoccus elongatus. To be Published
    Site NESGC
    PDB Id 3bdr Target Id TeR13
    Molecular Characteristics
    Source Thermosynechococcus elongatus
    Alias Ids TPS9219,PF09367, BIG_280, 2.40.128.20 Molecular Weight 20362.04 Da.
    Residues 182 Isoelectric Point 5.23
    Sequence mcigmdirdffaqsagrwfsqrtshhlafkqtesgksqltiellsvddpavialcqqydmdpawavcga rvswdgtmewdnekhegstvlvpimdqgsrmegkllremgyaekapvagrfsmgsdgaltliteyetiy seerlwfaspnlrlrtsilkrfggfsmasfcseirlgvtqpans
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.80 Rfree 0.262
    Matthews' coefficent 2.68 Rfactor 0.236
    Waters 1 Solvent Content 54.11

    Ligand Information
    Ligands PO4 (PHOSPHATE) x 1
    Metals

    Jmol

     
    Google Scholar output for 3bdr
    1. Phycobiliprotein biosynthesis in cyanobacteria: structure and function of enzymes involved in post-translational modification
    WM Schluchter, G Shen, RM Alvey, A Biswas - Recent Advances in , 2010 - Springer
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch