.
The Open Protein Structure Annotation Network
PDB Keyword
.

3b57

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of the Lin1889 protein (Q92AN1) from Listeria innocua. To be Published
    Site NESGC
    PDB Id 3b57 Target Id LkR65
    Molecular Characteristics
    Source Listeria innocua
    Alias Ids TPS8950,1.10.472.50, 1.10.3210.10, PF01966, BIG_264 Molecular Weight 23225.44 Da.
    Residues 201 Isoelectric Point 7.07
    Sequence mnkeeiilsaknwmhshfenettghdwshikrvwklskeiqskeggdlftielaalfhdysdiklttde qeatktlinwmetkeipselikkiiriiqsvsfkkgkntfkaltieekivqdadrldaigaigiartft yggahnreianqnnpknttlqhfydklllikdqlntetaktiakekqkimqdfiqalekelkv
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 3.00 Rfree 0.2497
    Matthews' coefficent 3.44 Rfactor 0.2138
    Waters Solvent Content 64.23

    Ligand Information
    Ligands
    Metals MG (MAGNESIUM) x 1

    Jmol

     
    Google Scholar output for 3b57

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch