The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Solution NMR Structure of Uncharacterized Protein Cv0863 from Chromobacterium Violaceum. To be Published
    Site NESGC
    PDB Id 2x8n Target Id CvT3
    Molecular Characteristics
    Source Chromobacterium violaceum
    Alias Ids TPS33493,16790, PF12050 Molecular Weight 12310.15 Da.
    Residues 109 Isoelectric Point 4.56
    Sequence mevsaneleaassrmemlqreystlrsvqyrseegvivfilandrelkfrpddlqatygatpeqlreie ispsglgvyfetleedvsligllegrrgsakwmaehplas
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information


    Google Scholar output for 2x8n
    1. A novel strategy for NMR resonance assignment and protein structure determination
    A Lemak, A Gutmanas, S Chitayat, M Karra - Journal of biomolecular , 2011 - Springer

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch